Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human PGRMC1 (67-102aa RLKRRDFTPAELRRFDGVQDPRILMAINGKVFDVTK), identical to the related mouse sequence, and different from the related rat sequence by two amino acids.
The best product, quick delivery, high quality.
A synthetic peptide corresponding to a sequence in the middle region of human PGRMC1 (67-102aa RLKRRDFTPAELRRFDGVQDPRILMAINGKVFDVTK), identical to the related mouse sequence, and different from the related rat sequence by two amino acids.
At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid repeated freezing and thawing.
This antibody needs to be stored at + 4°C in a fridge short term in a concentrated dilution. Freeze thaw will destroy a percentage in every cycle and should be avoided.
Immunohistochemistry(Paraffin-embedded Section), 0.5-1µg/ml, Human, Mouse, Rat, By Heat Western blot, 0.1-0.5µg/ml, Human, Mouse, Rat
If you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
www.bosterbio.com/datasheet.php?sku=PB9775
No cross reactivity with other proteins.
30ug for $99, contact us for details
Immunogen affinity purified.
Human, Mouse, Rat
Lyophilized
Polyclonal
anticorps
IHC, WB
N/A