Quick contact, quick delivery, greatests product price.
This is a rabbit polyclonal antibody against PGRMC1. It was validated on Western Blot and immunohistochemistry. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at antibodies@fitzgerald-fii.com
PGRMC1 antibodies were raised using the N terminal of PGRMC1 corresponding to a region with amino acids MAAEDVVATGADPSDLESGGLLHEIFTSPLNLLLLGLCIFLLYKIVRGDQ
PGRMC1 Blocking Peptide, catalog no. 33R-5590, is also available for use as a blocking control in assays to test for specificity of this PGRMC1 antibody
If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PGRMC1 antibody in PBS
PGRMC1 antibody was raised against the N terminal of PGRMC1
Polyclonal Antibodies, Purified
WB: 0.25 ug/ml; IHC: 4-8 ug/ml
Hormones & Steroids
Affinity purified
Primary Antibody
anticorps
Blue Ice
WB; IHC
1 mg/ml
Rabbit
Human