Laminin Gamma 1 antibody

The best product, quick delivery, high quality.

Size

50 µg

Catalog no

70R-6061
product photo

Click and buy. Our professional team will take care of your order immediately.

Get on Gentaur.com

Additional Information

This is a rabbit polyclonal antibody against LAMC1, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at antibodies@fitzgerald-fii.com

Assay Information

Laminin Gamma 1 Blocking Peptide, catalog no. 33R-3677, is also available for use as a blocking control in assays to test for specificity of this Laminin Gamma 1 antibody

Type of Immunogen

Laminin Gamma 1 antibodies were raised using a synthetic peptide corresponding to a region with amino acids GYHVKTEDPDLRTSSWIKQFDTSRFHPQDLSRSQKCIRKEGSSEISQRVQ

Properties

If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.

Storage

Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

Form & Buffer

Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LAMC1 antibody in PBS

Antibody Subtype

Polyclonal Antibodies, Purified

Method of Purification

Affinity purified

Category

Primary Antibody

Area of research

Cell Biology

Usage Recommendations

WB: 1 ug/ml

French translation

anticorps

Shipping conditions

Blue Ice

Concentration

1 mg/ml

Raised in

Rabbit

Cross Reactivity

Human

Tested for

WB

We'd like to talk with you about your business and needs.

Contact Us