The best product, quick delivery, high quality.
This is a rabbit polyclonal antibody against LAMC1, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at antibodies@fitzgerald-fii.com
Laminin Gamma 1 Blocking Peptide, catalog no. 33R-3677, is also available for use as a blocking control in assays to test for specificity of this Laminin Gamma 1 antibody
Laminin Gamma 1 antibodies were raised using a synthetic peptide corresponding to a region with amino acids GYHVKTEDPDLRTSSWIKQFDTSRFHPQDLSRSQKCIRKEGSSEISQRVQ
If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LAMC1 antibody in PBS
Polyclonal Antibodies, Purified
Affinity purified
Primary Antibody
Cell Biology
WB: 1 ug/ml
anticorps
Blue Ice
1 mg/ml
Rabbit
Human
WB