The best product, quick delivery, high quality.
Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
PGRMC1 antibody was raised using the N terminal of PGRMC1 corresponding to a region with amino acids MAAEDVVATGADPSDLESGGLLHEIFTSPLNLLLLGLCIFLLYKIVRGDQ
If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PGRMC1 antibody in PBS
PGRMC1 antibody was raised against the N terminal of PGRMC1
Purified Polyclonal Antibodies
Oryctolagus cuniculus
Hormones & Steroids
Primary Antibodies
anticorps
Blue Ice
WB, IHC
1 mg/ml
Human
NA